PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID model.Picochlorum_contig_29.g74.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Trebouxiophyceae incertae sedis; Picochlorum
Family Nin-like
Protein Properties Length: 366aa    MW: 40494.2 Da    PI: 6.2435
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
model.Picochlorum_contig_29.g74.t1genomeRutgersView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK63.82.8e-20111154346
                              RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPh 46 
                                         ++i+le+++ yF+lp  +AA+ +g++lT+LKr CR++G++RWP+
  model.Picochlorum_contig_29.g74.t1 111 SDITLEEMQGYFHLPAYEAARRMGIGLTILKRLCRKFGVQRWPY 154
                                         78*****************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151918.04194181IPR003035RWP-RK domain
PfamPF020427.6E-18113156IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MVPATGTEDG VPDKFNSSDT PISSDTSDTE STEDGEHENN QEYNSSPKED HESGAGSSLK  60
FVSGETANNQ SGSRKESVHK SDDGTTGKSD IVKGRSRSAS RKRTKSGRYT SDITLEEMQG  120
YFHLPAYEAA RRMGIGLTIL KRLCRKFGVQ RWPYQRKRFS DMKEEELLEH AQAHLRQQTA  180
VAPTGQQEQQ RPELHALVEQ LLVMLGNQGA TPYQPGYPMP SYQGEGQFPG SLPPHIAGLS  240
GPSIASMAQA YFPPQGSHSD VVFPAAQPVD HAQMHSGSMQ TQQSERTGTG NYLDAVQAYW  300
KRQQDIQQDP GSAFRPFSDT RNTDRPIDTS NAWLLSSSGR FGGTSEEEFR NRNFAAHYRK  360
EDERQ*
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP841650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35590.12e-12RWP-RK domain-containing protein